DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and CIRBP

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens


Alignment Length:146 Identity:42/146 - (28%)
Similarity:68/146 - (46%) Gaps:23/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETA-LAMN 157
            |...::||.:.:..:.:.||..|...|.|:.|.::.::.....:||.::.|.:.:..:.| :|||
Human     4 DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68

  Fly   158 ETLFRGRQIKVMSKRTNRPGLSTTNR-------------FARGSFRGRGARVSRACCHSTFRGAR 209
            .....||||:|     ::.|.|:.||             |.||. ||||...||......:.|.|
Human    69 GKSVDGRQIRV-----DQAGKSSDNRSRGYRGGSAGGRGFFRGG-RGRGRGFSRGGGDRGYGGNR 127

  Fly   210 ---RAMGYRGRANYYA 222
               |:.||.|..:||:
Human   128 FESRSGGYGGSRDYYS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 20/75 (27%)
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 21/83 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.