DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and RNPS1

DIOPT Version :10

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_006702.1 Gene:RNPS1 / 10921 HGNCID:10080 Length:305 Species:Homo sapiens


Alignment Length:58 Identity:15/58 - (25%)
Similarity:28/58 - (48%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGH-PKGFAYIEFGSKEFVETAL 154
            |::|.:....:.:.:...|...|.|..:.:...:...| .||:||:||.:.:..|.||
Human   163 VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKAL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 15/58 (26%)
RNPS1NP_006702.1 Necessary for interaction with the cleaved p110 isoform of CDC2L1 1..220 13/56 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..170 2/6 (33%)
Necessary for interaction with SRP54, nuclear localization and exon-skipping. /evidence=ECO:0000269|PubMed:14729963 1..161
Necessary for interactions with UPF2 and UPF3B and UPF2-dependent NMD 69..121
Necessary for interaction with PNN and exon-skipping 156..242 15/58 (26%)
Interaction with SAP18 and ACIN1. /evidence=ECO:0000269|PubMed:20966198 159..244 15/58 (26%)
RRM_RNPS1 163..236 CDD:409800 15/58 (26%)
Necessary for interaction with TRA2B, nuclear localization and exon-skipping. /evidence=ECO:0000269|PubMed:14729963 238..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.