DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pabp2 and BCL2L2-PABPN1

DIOPT Version :9

Sequence 1:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001374269.1 Gene:BCL2L2-PABPN1 / 100529063 HGNCID:42959 Length:372 Species:Homo sapiens


Alignment Length:231 Identity:129/231 - (55%)
Similarity:158/231 - (68%) Gaps:14/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EDITLNEDQLLES---LEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQMQ 65
            |...|..|..||.   |.|.|......:.|.....|::    |||||||||:||||||||:|::|
Human   146 EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGAL----ELEAIKARVREMEEEAEKLKELQ 206

  Fly    66 SEVDKQMAGGSTTGLA-TVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILC 129
            :||:|||......|.| .|.:|:|||.|.|.||:|||||||||:||||||||||||::|||||||
Human   207 NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC 271

  Fly   130 NKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNR-FARGSFRGRG 193
            :|..|||||||||||..||.|.|:||::|:|||||||||:.|||||||:|||:| |.|..:|.|.
Human   272 DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART 336

  Fly   194 ARV--SRACCHSTFRGARRAMGYRGRA---NYYAPY 224
            ...  ||:..:|.|....|...|||||   ::|:||
Human   337 TNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 91/129 (71%)
RRM_II_PABPN1 97..172 CDD:240994 57/74 (77%)
BCL2L2-PABPN1NP_001374269.1 bcl-2 11..185 CDD:273308 10/42 (24%)
RRM_II_PABPN1 239..314 CDD:409966 57/74 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101686
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.