DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs3

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_446017.1 Gene:Socs3 / 89829 RGDID:621087 Length:225 Species:Rattus norvegicus


Alignment Length:204 Identity:48/204 - (23%)
Similarity:86/204 - (42%) Gaps:43/204 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LEREDAHSPNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRI 229
            |:...:.|..|::..|..::....:||..::..::...||.:|.|:||:|||......||||...
  Rat    22 LKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVET 86

  Fly   230 VNVTLHYRLEYRDNFWHFEE--------LKYESIVEMIEDILHRCTNDNFVCFVKVPNE------ 280
            .:.|.:.|::.....:..:.        .:::.:::::.   |.........|...|.|      
  Rat    87 QSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVH---HYMPPPGAPSFSLPPTEPSFEVQ 148

  Fly   281 MQPP---------------------FPVILKYPLSRYSNMPKLQDLCRRVLQRQM-SREQLAQLP 323
            .|||                     .|::|..|||  ||:..||.|||:.:...: |.|::.|||
  Rat   149 EQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLS--SNVATLQHLCRKTVNGHLDSYEKVTQLP 211

  Fly   324 VPAQMLEYL 332
            .|.:  |:|
  Rat   212 GPIR--EFL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 18/85 (21%)
SOCS 293..333 CDD:295349 17/41 (41%)
Socs3NP_446017.1 Kinase inhibitory region (KIR) 22..33 2/10 (20%)
Extended SH2 subdomain (ESS) 34..45 1/10 (10%)
SH2_SOCS3 35..135 CDD:198247 19/102 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..160 4/18 (22%)
SOCS_SOCS3 184..225 CDD:239706 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336658
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.