DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and SOCS1

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_003736.1 Gene:SOCS1 / 8651 HGNCID:19383 Length:211 Species:Homo sapiens


Alignment Length:202 Identity:52/202 - (25%)
Similarity:85/202 - (42%) Gaps:49/202 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PAICPEPTLPFTH--------DYLRFIRKKWLEREDAHSPNQIMYKACSEMLNQVWYWGEISRRD 198
            ||: |.|....||        ||.|..|.            ..:..||.      :|||.:|...
Human    43 PAV-PAPAPGDTHFRTFRSHADYRRITRA------------SALLDACG------FYWGPLSVHG 88

  Fly   199 SQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELK--YESIVEMIED 261
            :..:|..:|.|:||||||......|.||.::.:.....|:.::...:|.:..:  ::.:.|::|.
Human    89 AHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEH 153

  Fly   262 ILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPA 326
                        :|..|..|       |..|| |...:..||:|||:.:...:.||.||::|:..
Human   154 ------------YVAAPRRM-------LGAPL-RQRRVRPLQELCRQRIVATVGRENLARIPLNP 198

  Fly   327 QMLEYLS 333
            .:.:|||
Human   199 VLRDYLS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 20/79 (25%)
SOCS 293..333 CDD:295349 13/39 (33%)
SOCS1NP_003736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 4/10 (40%)
Kinase inhibitory region (KIR) 55..66 2/10 (20%)
Extended SH2 subdomain (ESS) 67..78 2/22 (9%)
SH2_SOCS1 68..165 CDD:198245 27/133 (20%)
SOCS_SOCS1 169..211 CDD:239704 13/37 (35%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 173..182 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142954
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5357
Isobase 1 0.950 - 0 Normalized mean entropy S6278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.