DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs2

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_038935918.1 Gene:Socs2 / 84607 RGDID:69273 Length:213 Species:Rattus norvegicus


Alignment Length:188 Identity:48/188 - (25%)
Similarity:83/188 - (44%) Gaps:31/188 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EDAHSPNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNV 232
            ||.......:.||..|:....||||.::..:::.:|.:.|.|:||:|||..|....|:|.:....
  Rat    27 EDQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAG 91

  Fly   233 TLHYRLEYRDNFWHFEEL--------KYESIVEMIEDILHRCTNDNFVCFVKVPNEMQPPFP--- 286
            ..:.|:||:|..:..:.:        :::|:|.:|:..:..|.:          ....|..|   
  Rat    92 PTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKD----------KRTGPEAPRNG 146

  Fly   287 ---VILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPAQMLEYLSVERELVFQ 341
               :.|..||  |::.|.||..||  |........:..||:|.::.:||   .|..||
  Rat   147 TVHLYLTKPL--YTSAPTLQHFCR--LSINKCTGTIRGLPLPTRLKDYL---EEYKFQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 22/85 (26%)
SOCS 293..333 CDD:295349 12/39 (31%)
Socs2XP_038935918.1 SH2_SOCS2 40..142 CDD:198246 25/111 (23%)
SOCS 158..197 CDD:413360 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.