DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs5

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_062628.2 Gene:Socs5 / 56468 MGIID:2385459 Length:536 Species:Mus musculus


Alignment Length:482 Identity:101/482 - (20%)
Similarity:169/482 - (35%) Gaps:174/482 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QSQNQSSQRSQAL-------TGGGDSP------RDREKEKKGW----FHSLTRRKKSDSALAVTA 53
            ::||.:::..|.:       :..|.:|      ||.......|    .||.:  .|:.|:|....
Mouse    78 RNQNCAAEIPQVVEISIEKDSDSGATPGTRLARRDSYSRHAPWGGKKKHSCS--TKTQSSLDTEK 140

  Fly    54 SAAVSTSGSQNNNNEVCVLEAADSSMASCSNGGTGTGTLRRR-------------RDKDKRNVFA 105
            ....:.||.|.......|....|  |.|.|:...|:.:||:|             ..|..:.:|:
Mouse   141 KFGRTRSGLQRRERRYGVSSMQD--MDSVSSRAVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFS 203

  Fly   106 RLRRKV--------------GQGLSSLRNWH------------------------SMGDCDDG-- 130
            . :||:              |..|:  :.||                        |..|.:|.  
Mouse   204 N-KRKIHLSELMLEKCPFPAGSDLA--QKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLR 265

  Fly   131 -------------------GTTDATYEF-----LTPAICPEPT--------LPFTHD-------- 155
                               .|.:||.:.     |.|.:.|..|        :|.|:.        
Mouse   266 ERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDGSAIPQTNCDSEEDSTT 330

  Fly   156 -YLRFIRKKWLERE---DAHS----------PNQIMYKAC-----SEMLNQVWYWGEISRRDSQR 201
             .|:..|:|  :|:   |:|:          ..||.|..|     .::.....|||.:.|.:::.
Mouse   331 LCLQSRRQK--QRQVSGDSHAHVSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEA 393

  Fly   202 QLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELKYESIVEMIED--ILH 264
            .|..||.|:||:|||......|::|||..|.:||.|:|..::.:.|:          ..|  :.|
Mouse   394 LLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFD----------AHDPCVFH 448

  Fly   265 RCTNDNFVCFVKVPNE---MQPPFPVILK--YPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPV 324
            ..|....:...|.|:.   .:|...:.|.  :|.|       ||.:||.|:.|..:.:.:..||:
Mouse   449 SSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFS-------LQYICRAVICRCTTYDGIDGLPL 506

  Fly   325 PAQMLEYLS------------VERELV 339
            |:.:.::|.            :|||.|
Mouse   507 PSMLQDFLKEYHYKQKVRVRWLEREPV 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 25/79 (32%)
SOCS 293..333 CDD:295349 10/39 (26%)
Socs5NP_062628.2 Required for interaction with IL4R 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..175 19/83 (23%)
SOCS 146..195 CDD:372221 12/50 (24%)
SH2 370..470 CDD:387587 28/109 (26%)
SOCS_SOCS5 479..534 CDD:239708 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.