DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and socs6

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_687041.2 Gene:socs6 / 558703 -ID:- Length:519 Species:Danio rerio


Alignment Length:155 Identity:59/155 - (38%)
Similarity:87/155 - (56%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 EMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHF 247
            ::..|.||||.|:|.:::.:|.:.|.||||||||.......:||||....|||.|:|:.:..:.|
Zfish   362 KLAKQGWYWGPITRWEAEEKLVNLPDGSFLVRDSSDDRYLLSLSFRSQGKTLHTRIEHSNGRFSF 426

  Fly   248 EELK----YESIVEMIEDILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRR 308
            .|..    :.|||::||..:....|..| |:.:........:||.|..|:||:..:..||.|||.
Zfish   427 YEQPDVEGHTSIVDLIEHSIKDSENGAF-CYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRF 490

  Fly   309 VLQRQMSREQLAQ-LPVPAQMLEYL 332
            |: ||.:|..|.| ||:|.:|.:||
Zfish   491 VI-RQYTRIDLIQKLPLPNKMKDYL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 32/81 (40%)
SOCS 293..333 CDD:295349 19/41 (46%)
socs6XP_687041.2 SH2_SOCS6 357..456 CDD:198250 35/94 (37%)
SOCS_SOCS6 479..519 CDD:239709 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.