DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs6

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_061291.2 Gene:Socs6 / 54607 MGIID:1924885 Length:533 Species:Mus musculus


Alignment Length:239 Identity:72/239 - (30%)
Similarity:107/239 - (44%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 GGTTDATYEFLTPAICPEPTLPFTHDYLRFIRKKWLEREDAH-----------SPNQI------- 176
            ||..||..  |:|.:.|....|...::      ..|...|.|           .||..       
Mouse   300 GGHDDAPP--LSPLLPPMQNNPIQRNF------SGLSGPDLHMAESVRCHLNFDPNSAPGVARVY 356

  Fly   177 -------------MYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFR 228
                         :.:...::..|.||||.|:|.:::.:|::.|.||||||||.......:||||
Mouse   357 DSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFR 421

  Fly   229 IVNVTLHYRLEYRDNFWHFEELK----YESIVEMIEDILHRCTNDNFVCFVKVPNEMQPPFPVIL 289
            ....|||.|:|:.:..:.|.|..    :.|||::||..:....|..| |:.:........:||.|
Mouse   422 SHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAF-CYSRSRLPGSATYPVRL 485

  Fly   290 KYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQ-LPVPAQMLEYL 332
            ..|:||:..:..||.|||.|: ||.:|..|.| ||:|.:|.:||
Mouse   486 TNPVSRFMQVRSLQYLCRFVI-RQYTRIDLIQKLPLPNKMKDYL 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 32/81 (40%)
SOCS 293..333 CDD:295349 19/41 (46%)
Socs6NP_061291.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..199
SH2_SOCS6 371..470 CDD:198250 35/99 (35%)
SOCS_SOCS6 493..533 CDD:239709 17/37 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.