DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Sla2

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001165589.1 Gene:Sla2 / 499931 RGDID:1562071 Length:263 Species:Rattus norvegicus


Alignment Length:321 Identity:69/321 - (21%)
Similarity:115/321 - (35%) Gaps:88/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SLTRRKKSDSALAVTASAAVSTSGSQNNNNEVCVLEAADSSMASCSNGGTGTGTLRRRRDKDKRN 102
            ||..|.|:.|     .|::.|.||.   ..|...::|....:::.:.|....|..          
  Rat     4 SLPSRGKNSS-----PSSSSSFSGP---GQEPVSIQAERQKVSAVALGSFPAGEQ---------- 50

  Fly   103 VFARLRRKVGQGLSSLRNWHSMGDCDDGGTTDATYEFLTPAICPEPTLPFTHDYLRFIRKKWLER 167
              |||..:||:.|:.:        .:||.......|                          :..
  Rat    51 --ARLSLRVGEPLTII--------SEDGDWWTVQSE--------------------------VSG 79

  Fly   168 EDAHSPNQIMYKACSEMLNQVWYWGEISRRDSQR--QLSDKPTGSFLVRDSETSGSQFTLSFRIV 230
            .:.|.|:..:.|     ::..|.:..:||..::.  .|...|.|:||:|:|:|....::||.|:.
  Rat    80 REYHIPSVYVAK-----VSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGCYSLSIRLS 139

  Fly   231 NVT-----LHYRLEYRDNFWHF--EELKYESIVEMIEDILHRCTNDNFVCFVKVPNEMQ------ 282
            ...     .|||::..||.|.:  ..|.:.|:..::|......  |...|.::.|..:|      
  Rat   140 RPASWDRIRHYRIQRLDNGWLYISPRLTFPSLHALVEHYSELA--DGICCALREPCVLQKLGPLP 202

  Fly   283 ---PPFPVILKYPLSRYSNMPKLQD--LCRRVLQRQMSRE-QLAQLPVPAQMLEYLSVERE 337
               .|.||.:  |.|.. |..||..  ||   |....|.| .|....:...:..|:|:..|
  Rat   203 GKDTPLPVTV--PTSSL-NWKKLDRSLLC---LDAPASGEASLLSEGLRESLSSYISLTEE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 23/86 (27%)
SOCS 293..333 CDD:295349 11/42 (26%)
Sla2NP_001165589.1 SH3 39..92 CDD:302595 14/103 (14%)
SH2_SLAP 85..187 CDD:198207 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.