DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and socs1a

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001003467.1 Gene:socs1a / 445073 ZFINID:ZDB-GENE-040801-205 Length:201 Species:Danio rerio


Alignment Length:162 Identity:34/162 - (20%)
Similarity:75/162 - (46%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 QIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLE 239
            :|:....|.:....:|||.::..::..:|..:..|:||:|||..|...||||::..|..:..|:.
Zfish    55 KIISNTTSMLEESGFYWGPMTVEEAHLKLKKESVGTFLIRDSRQSDVFFTLSYKAQNGPVSIRIN 119

  Fly   240 YRDNFWHFEELK--YESIVEMIEDILHRCTNDNFVCFVKVPNE--MQPPFPVILKYPLSRYSNMP 300
            ::::.:.....|  ::|:.:::|.            ::..|.:  ::|          .|...:.
Zfish   120 FKNSKFSLTGSKESFDSLFKLLEH------------YISSPKKGLIRP----------CRKEPVQ 162

  Fly   301 KLQDLCRRVLQRQMSREQLAQLPVPAQMLEYL 332
            .||.||||.:..:...:.:..:||...:.::|
Zfish   163 SLQQLCRRQIMERCDGKDIDCIPVQPILKDFL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 20/79 (25%)
SOCS 293..333 CDD:295349 10/40 (25%)
socs1aNP_001003467.1 SH2_SOCS1 58..155 CDD:198245 22/108 (20%)
SOCS 161..198 CDD:295349 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.