DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and socs3l

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_988992.1 Gene:socs3l / 394588 XenbaseID:XB-GENE-5809273 Length:211 Species:Xenopus tropicalis


Alignment Length:245 Identity:59/245 - (24%)
Similarity:105/245 - (42%) Gaps:73/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NVFARLRRKVGQGLSSLRNWHSMGDCDDGGTTDATYEFLTPAICPEPTLPFTHDYLRFIRKKWLE 166
            ::||.:.|:..|     .::|....|.|       ||.:..|                     ||
 Frog    17 SIFAAMNRQAAQ-----LSYHYKSFCGD-------YERVETA---------------------LE 48

  Fly   167 REDAHSPNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVN 231
            |.:|..                :||..:|..::::.|||:|.||||:|||......||||.|...
 Frog    49 RLEASG----------------YYWSTLSGTEAKKLLSDQPVGSFLIRDSSDHHHLFTLSLRTSA 97

  Fly   232 VTLHYRLEYRDNFWHFEEL-------KYESIVEMIEDILHRCT----NDNFVCFVKVPNEMQPPF 285
            ...:.|::.....::.|.:       .:..:|:::|..: |.|    :|:.:|:::..::   |.
 Frog    98 GITNLRIKLEGPSFYLETVAGAESPHTFPCVVKLVEHYM-RLTAAGESDSNLCYIEGNDQ---PV 158

  Fly   286 PVILKYPLSRYSNMPKLQDLCRRVLQRQM------SREQLAQLPVPAQML 329
            |::|..||:  ..:..||.||:|.:...|      |.|.:.:||| ::||
 Frog   159 PLMLTQPLN--CKVVSLQYLCKRTVVANMPAEASSSGENMEELPV-SKML 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 23/84 (27%)
SOCS 293..333 CDD:295349 14/43 (33%)
socs3lNP_988992.1 SH2_SOCS3 44..143 CDD:198247 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5105
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5278
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.