DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and socs3a

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_956244.1 Gene:socs3a / 335409 ZFINID:ZDB-GENE-030131-7349 Length:207 Species:Danio rerio


Alignment Length:205 Identity:50/205 - (24%)
Similarity:82/205 - (40%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LPFTHDYLRFIRKKWLEREDAHSPNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVR 214
            |||.| :..|..|...         |::......:....:|||.||.:::...||.:|:|:||||
Zfish    22 LPFYH-FKTFSSKVQF---------QLVQHTIRMLQESGFYWGAISGKEANHLLSSEPSGTFLVR 76

  Fly   215 DSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELKYESIVEMIEDILHRCTNDNFVCFVKVPN 279
            ||..:...||||.:..:.|.:.|::. ||...|.:...:|:..:          ..|.|.:::..
Zfish    77 DSSDNRHFFTLSVKTESGTKNLRVQC-DNKSFFLQTDSKSMQSV----------PRFDCVLRLVQ 130

  Fly   280 EMQPPFPVILKYPLSRY------------------SNMPKLQDLCRRVLQR----QMSREQLAQL 322
            ...|...:.:..|.|.|                  .:|..||.|||:.:..    ...||.|   
Zfish   131 HYMPRSALSIGIPRSSYYIYTGGEKIPLELLRPLQCSMSSLQHLCRKTVNGHTDVSSKREHL--- 192

  Fly   323 PVPAQMLEYL 332
              |.|:.::|
Zfish   193 --PQQLKDFL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 25/77 (32%)
SOCS 293..333 CDD:295349 14/62 (23%)
socs3aNP_956244.1 SH2_SOCS3 40..139 CDD:198247 28/109 (26%)
SOCS 167..207 CDD:295349 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5344
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.