DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Pi3K21B

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001259817.1 Gene:Pi3K21B / 33203 FlyBaseID:FBgn0020622 Length:496 Species:Drosophila melanogaster


Alignment Length:88 Identity:30/88 - (34%)
Similarity:46/88 - (52%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 PNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYR 237
            ||:      .|:....||||.|||.:::..|..||.|||||||:.:...::||:..........:
  Fly    12 PNE------DELRMAPWYWGRISREEAKSILHGKPDGSFLVRDALSMKGEYTLTLMKDGCEKLIK 70

  Fly   238 LEYRDNFWHFEELK-YESIVEMI 259
            :.:.|..:.|.|.. :.|:||||
  Fly    71 ICHMDRKYGFIETDLFNSVVEMI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 27/73 (37%)
SOCS 293..333 CDD:295349
Pi3K21BNP_001259817.1 SH2_nSH2_p85_like 14..123 CDD:198195 28/86 (33%)
PI3K_P85_iSH2 129..302 CDD:293063
iSH2_PI3K_IA_R 138..303 CDD:304922
SH2_cSH2_p85_like 320..422 CDD:198184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10155
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.