DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs16D

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:338 Identity:88/338 - (26%)
Similarity:141/338 - (41%) Gaps:74/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EKKGWFHSLTRRKKSDSALAVTASAAVSTSGSQNNNN------------------EVCVLEAA-- 75
            |||..| :|..:::..|......|......||.||..                  .:.|:.:|  
  Fly   699 EKKSQF-TLNLKQRFCSIFRFRRSNHSRCRGSGNNQTGTFASANANAAATAPLIPPIAVITSAPG 762

  Fly    76 ---DSSMASCSNGGTGTGTLRRRRDKDKRNVFARLRRKVGQGLSSLRNWHSMGDCDDGGTTDATY 137
               .:.:||..||...|.      :.|:.|  |.||:|                           
  Fly   763 AAGQTQLASELNGTLITA------EADEPN--ADLRKK--------------------------- 792

  Fly   138 EFLTPAICPEP--TLPFTHDYLRFIRKKWLEREDA-----HSPNQIMYKACSEMLNQV-WYWGEI 194
             |.:.|:.|.|  .||||.........| .|.|:.     ..|..:.:.:..|.:... ||||.:
  Fly   793 -FQSRALPPLPKKALPFTAAAYAIEAVK-SEPEEVKTNAIQEPRALQFTSSIEKVKDYGWYWGPL 855

  Fly   195 SRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRD---NFWHFEELKYESIV 256
            |...:::.||.:|.|||:||||......|:|||::.|...|.|:|...   :|..:.:.|.::|.
  Fly   856 SSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQTIT 920

  Fly   257 EMIEDILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQ 321
            |.||..:....:..::.|:....| ..|..|.|..|:||:.::..||.:||.|:.:.:.|:.|.|
  Fly   921 EFIEKAVEHSRSGRYLFFLHRRPE-HGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQ 984

  Fly   322 -LPVPAQMLEYLS 333
             ||:|.::|:||:
  Fly   985 TLPLPRRLLDYLN 997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 29/81 (36%)
SOCS 293..333 CDD:295349 15/40 (38%)
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 30/97 (31%)
SOCS_SOCS7 960..1009 CDD:239710 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D218620at33208
OrthoFinder 1 1.000 - - FOG0006587
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10155
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.