DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs6

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001258078.1 Gene:Socs6 / 307200 RGDID:1304632 Length:547 Species:Rattus norvegicus


Alignment Length:239 Identity:72/239 - (30%)
Similarity:107/239 - (44%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 GGTTDATYEFLTPAICPEPTLPFTHDYLRFIRKKWLEREDAH-----------SPNQI------- 176
            ||..||..  |:|.:.|....|...::      ..|...|.|           .||..       
  Rat   314 GGHDDAPP--LSPLLPPMQNNPIQRNF------SGLSGPDLHMAESVRCHLNFDPNSAPGVARVY 370

  Fly   177 -------------MYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFR 228
                         :.:...::..|.||||.|:|.:::.:|::.|.||||||||.......:||||
  Rat   371 DSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFR 435

  Fly   229 IVNVTLHYRLEYRDNFWHFEELK----YESIVEMIEDILHRCTNDNFVCFVKVPNEMQPPFPVIL 289
            ....|||.|:|:.:..:.|.|..    :.|||::||..:....|..| |:.:........:||.|
  Rat   436 SHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAF-CYSRSRLPGSATYPVRL 499

  Fly   290 KYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQ-LPVPAQMLEYL 332
            ..|:||:..:..||.|||.|: ||.:|..|.| ||:|.:|.:||
  Rat   500 TNPVSRFMQVRSLQYLCRFVI-RQYTRIDLIQKLPLPNKMKDYL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 32/81 (40%)
SOCS 293..333 CDD:295349 19/41 (46%)
Socs6NP_001258078.1 SH2_SOCS6 385..484 CDD:198250 35/99 (35%)
SOCS_SOCS6 507..547 CDD:239709 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.