DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs4

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001100726.1 Gene:Socs4 / 305828 RGDID:1306503 Length:436 Species:Rattus norvegicus


Alignment Length:346 Identity:84/346 - (24%)
Similarity:130/346 - (37%) Gaps:109/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ALTGGGDS----------PRDREKEKKGWFHSLTRRKKSDSALAVTASAAVSTSGSQNNNNEVCV 71
            ||:...|.          |||.:         |.||...|.....:.::.           :.||
  Rat   150 ALSSSSDEWVSTDLCERRPRDAQ---------LKRRSTEDDIPCFSHTSV-----------QPCV 194

  Fly    72 LEAADSSMASCSNGGTGTGTLRRRRDKDKRNVFARLRRKVGQGLSSLRNWHSMGDCDDGGTTDAT 136
            :   .::.|||: ||..||:                       |.:|...:||.|    |..|:.
  Rat   195 I---TTNSASCA-GGHVTGS-----------------------LMNLVTDNSMED----GDMDSE 228

  Fly   137 YEFLTPAICPEPTLPFTHDYLRFIRK----KWLEREDA----HSP----NQIMYKAC-----SEM 184
            .|.:|  :|...            ||    :| |.:|.    .:|    .||.|..|     .::
  Rat   229 DEIIT--LCTSS------------RKRNKPRW-ETDDGILQLEAPPKFHTQIDYVHCLVPDLLQI 278

  Fly   185 LNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEE 249
            .|...|||.:.:..::..|..||.|:||:|||......|::|||..:.:||.|:|..::.:.|: 
  Rat   279 SNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFD- 342

  Fly   250 LKYESIVEMIEDI--LHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMP-KLQDLCRRVLQ 311
             .::..|....||  |.....|...|..         |..:|..||.|  ..| .||.:||.|:.
  Rat   343 -AHDPCVFHSPDITGLLEHYKDPSACMF---------FEPLLSTPLIR--TFPFSLQHICRTVIC 395

  Fly   312 RQMSREQLAQLPVPAQMLEYL 332
            ...:.:.:..||:|:.|..||
  Rat   396 NCTTYDGIDALPIPSPMKLYL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 25/79 (32%)
SOCS 293..333 CDD:295349 14/41 (34%)
Socs4NP_001100726.1 SOCS 58..105 CDD:289383
SH2_SOCS4 272..372 CDD:198248 29/110 (26%)
SOCS 381..436 CDD:295349 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.