DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs7

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_006247546.3 Gene:Socs7 / 287659 RGDID:1307720 Length:642 Species:Rattus norvegicus


Alignment Length:208 Identity:70/208 - (33%)
Similarity:104/208 - (50%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PEPTLPFTHDYLRFIRKKWLEREDAHS------------PNQIMYKACSEMLNQV-WYWGEISRR 197
            |.|..|.....:..||..    |..||            |:...:.|....|.:. ||||.::..
  Rat   409 PPPHAPDAFPRIAPIRAS----ESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWE 469

  Fly   198 DSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLE-YRDNF--W---HFEELKYESIV 256
            |::.:|..||.||||||||.......:||||...:|.|.|:| ||..|  |   .||: :.:|:|
  Rat   470 DAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFED-RCQSVV 533

  Fly   257 EMIEDILHRCTNDNFVCFV--KVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQL 319
            |.|:..:....|..|:.|:  :||.  .||.||.|.||:||:||:..||.|||..:::.:..:.:
  Rat   534 EFIKRAIMHSKNGKFLYFLRSRVPG--LPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHI 596

  Fly   320 AQLPVPAQMLEYL 332
            ..||:|..::.|:
  Rat   597 PDLPLPKPLISYI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 34/84 (40%)
SOCS 293..333 CDD:295349 13/40 (33%)
Socs7XP_006247546.3 SH2_SOCS7 450..550 CDD:198251 38/100 (38%)
SOCS_SOCS7 574..622 CDD:239710 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006587
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10155
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.