DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs2

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_017169385.1 Gene:Socs2 / 216233 MGIID:1201787 Length:267 Species:Mus musculus


Alignment Length:200 Identity:51/200 - (25%)
Similarity:89/200 - (44%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 RKKW----LEREDAHSPNQI-MYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSG 220
            |.:|    |..|  .||... :.||..|:....||||.::..:::.:|.:.|.|:||:|||..|.
Mouse    17 RSQWGTAGLPEE--QSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSD 79

  Fly   221 SQFTLSFRIVNVTLHYRLEYRDNFWHFEEL--------KYESIVEMIEDILHRCTNDNFVCFVKV 277
            ...|:|.:......:.|:||:|..:..:.:        :::|:|.:|:..:..|.:         
Mouse    80 YLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKD--------- 135

  Fly   278 PNEMQPPFP------VILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPAQMLEYLSVER 336
             ....|..|      :.|..||  |::.|.||..||..:.:  ....:..||:|.::.:||   .
Mouse   136 -KRTGPEAPRNGTVHLYLTKPL--YTSAPTLQHFCRLAINK--CTGTIWGLPLPTRLKDYL---E 192

  Fly   337 ELVFQ 341
            |..||
Mouse   193 EYKFQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 22/85 (26%)
SOCS 293..333 CDD:295349 11/39 (28%)
Socs2XP_017169385.1 SH2_SOCS2 40..142 CDD:198246 25/111 (23%)
SOCS 158..197 CDD:383010 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.