DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs7

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_619598.2 Gene:Socs7 / 192157 MGIID:2651588 Length:648 Species:Mus musculus


Alignment Length:208 Identity:70/208 - (33%)
Similarity:104/208 - (50%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PEPTLPFTHDYLRFIRKKWLEREDAHS------------PNQIMYKACSEMLNQV-WYWGEISRR 197
            |.|..|.....:..||..    |..||            |:...:.|....|.:. ||||.::..
Mouse   415 PPPHAPDAFPRIAPIRAS----ESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWE 475

  Fly   198 DSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLE-YRDNF--W---HFEELKYESIV 256
            |::.:|..||.||||||||.......:||||...:|.|.|:| ||..|  |   .||: :.:|:|
Mouse   476 DAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFED-RCQSVV 539

  Fly   257 EMIEDILHRCTNDNFVCFV--KVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQL 319
            |.|:..:....|..|:.|:  :||.  .||.||.|.||:||:||:..||.|||..:::.:..:.:
Mouse   540 EFIKRAIMHSKNGKFLYFLRSRVPG--LPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHI 602

  Fly   320 AQLPVPAQMLEYL 332
            ..||:|..::.|:
Mouse   603 PDLPLPKPLISYI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 34/84 (40%)
SOCS 293..333 CDD:295349 13/40 (33%)
Socs7NP_619598.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006587
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10155
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.