DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and F39B2.5

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_493574.2 Gene:F39B2.5 / 185487 WormBaseID:WBGene00009556 Length:192 Species:Caenorhabditis elegans


Alignment Length:167 Identity:47/167 - (28%)
Similarity:83/167 - (49%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 CSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFW 245
            ||::.:..||||::..:.::|.|...|.|.||:|||.:....||:|:...:...|.||...|:..
 Worm     8 CSDLYDCDWYWGDLDWKWAERLLLLCPIGYFLIRDSRSETHLFTVSYHFQDRVYHSRLSLEDSRR 72

  Fly   246 H------FEELKYESIVEMIEDILHR-CTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQ 303
            :      :....|.::||:||..|.: .|....:...:..:|.:.. .|.|..||::...:|.||
 Worm    73 NLGSRQPYVSRDYWNLVEIIERSLEQSLTGQQEMLHYRRGHEAEAA-RVNLTRPLTKRELLPSLQ 136

  Fly   304 DLCRRVLQRQMSREQLAQ-LPVPAQMLEYLSVERELV 339
            .|||..|:....:....: .|:|..:|:|||..:.::
 Worm   137 YLCRFTLKTSQQKPPTPKTAPLPPTILKYLSDSKWII 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 26/84 (31%)
SOCS 293..333 CDD:295349 12/40 (30%)
F39B2.5NP_493574.2 SH2_SOCS7 5..106 CDD:198251 29/97 (30%)
SOCS 126..169 CDD:128549 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006587
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3554
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.