DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and Socs1

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001258532.1 Gene:Socs1 / 12703 MGIID:1354910 Length:212 Species:Mus musculus


Alignment Length:202 Identity:52/202 - (25%)
Similarity:85/202 - (42%) Gaps:49/202 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PAICPEPTLPFTH--------DYLRFIRKKWLEREDAHSPNQIMYKACSEMLNQVWYWGEISRRD 198
            ||: |.|....||        ||.|..|            ...:..||.      :|||.:|...
Mouse    44 PAV-PAPAPGDTHFRTFRSHSDYRRITR------------TSALLDACG------FYWGPLSVHG 89

  Fly   199 SQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELK--YESIVEMIED 261
            :..:|..:|.|:||||||......|.||.::.:.....|:.::...:|.:..:  ::.:.|::|.
Mouse    90 AHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEH 154

  Fly   262 ILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPA 326
                        :|..|..|       |..|| |...:..||:|||:.:...:.||.||::|:..
Mouse   155 ------------YVAAPRRM-------LGAPL-RQRRVRPLQELCRQRIVAAVGRENLARIPLNP 199

  Fly   327 QMLEYLS 333
            .:.:|||
Mouse   200 VLRDYLS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 20/79 (25%)
SOCS 293..333 CDD:295349 13/39 (33%)
Socs1NP_001258532.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 4/11 (36%)
Kinase inhibitory region (KIR) 56..67 2/10 (20%)
Extended SH2 subdomain (ESS) 68..79 2/22 (9%)
SH2_SOCS1 69..166 CDD:198245 27/133 (20%)
SOCS 170..212 CDD:295349 13/37 (35%)
Interaction with Elongin BC complex 174..183 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.