Sequence 1: | NP_523659.1 | Gene: | Socs44A / 35786 | FlyBaseID: | FBgn0033266 | Length: | 342 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258532.1 | Gene: | Socs1 / 12703 | MGIID: | 1354910 | Length: | 212 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 52/202 - (25%) |
---|---|---|---|
Similarity: | 85/202 - (42%) | Gaps: | 49/202 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 PAICPEPTLPFTH--------DYLRFIRKKWLEREDAHSPNQIMYKACSEMLNQVWYWGEISRRD 198
Fly 199 SQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELK--YESIVEMIED 261
Fly 262 ILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPA 326
Fly 327 QMLEYLS 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Socs44A | NP_523659.1 | SH2_SOCS_family | 188..266 | CDD:198178 | 20/79 (25%) |
SOCS | 293..333 | CDD:295349 | 13/39 (33%) | ||
Socs1 | NP_001258532.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..55 | 4/11 (36%) | |
Kinase inhibitory region (KIR) | 56..67 | 2/10 (20%) | |||
Extended SH2 subdomain (ESS) | 68..79 | 2/22 (9%) | |||
SH2_SOCS1 | 69..166 | CDD:198245 | 27/133 (20%) | ||
SOCS | 170..212 | CDD:295349 | 13/37 (35%) | ||
Interaction with Elongin BC complex | 174..183 | 5/8 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833074 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4566 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6278 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.690 |