DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and SOCS4

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_543143.1 Gene:SOCS4 / 122809 HGNCID:19392 Length:440 Species:Homo sapiens


Alignment Length:275 Identity:74/275 - (26%)
Similarity:112/275 - (40%) Gaps:61/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GTLRRRRDKDKRNVFAR-------------LRRKVGQGLSSLRNWHSMGDCDDGGTTDATYEFLT 141
            |.|:||..::..|.|:.             |.|: |....|:.|..|....:| ...|:..|.||
Human   174 GQLKRRNMEENINCFSHTNVQPCVITTDNALCRE-GPMTGSVMNLVSNNSIED-SDMDSDDEILT 236

  Fly   142 PAICPEPTLPFTHDYLRFIRK----KW-LERE--DAHSP----NQIMYKAC-----SEMLNQVWY 190
              :|...            ||    || |:.|  ...:|    .||.|..|     .::.|...|
Human   237 --LCTSS------------RKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCY 287

  Fly   191 WGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELKYESI 255
            ||.:.:..::..|..||.|:||:|||......|::|||..:.:||.|:|..::.:.|:  .::..
Human   288 WGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFD--AHDPC 350

  Fly   256 VEMIEDI--LHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMP-KLQDLCRRVLQRQMSRE 317
            |....||  |.....|...|..         |..:|..||.|  ..| .||.:||.|:....:.:
Human   351 VFHSPDITGLLEHYKDPSACMF---------FEPLLSTPLIR--TFPFSLQHICRTVICNCTTYD 404

  Fly   318 QLAQLPVPAQMLEYL 332
            .:..||:|:.|..||
Human   405 GIDALPIPSSMKLYL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 25/79 (32%)
SOCS 293..333 CDD:295349 14/41 (34%)
SOCS4NP_543143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
SOCS 59..111 CDD:315310
SH2_SOCS4 275..375 CDD:198248 29/110 (26%)
SOCS_SOCS4 384..439 CDD:239707 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.