DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and CISH

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_037456.5 Gene:CISH / 1154 HGNCID:1984 Length:275 Species:Homo sapiens


Alignment Length:191 Identity:53/191 - (27%)
Similarity:84/191 - (43%) Gaps:33/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDN 243
            |..|.:....||||.|:..::::.|...|.|:||||||......||||.:......:.|:||.|:
Human    89 KTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADS 153

  Fly   244 FWHFEE--------LKYESIVEMIEDILHRCTNDNF--------VCFVKVPNEMQPPFPVI---- 288
            .:..:.        |.:..:|.:::..:..||.|..        ...:.:|.|..|..|.:    
Human   154 SFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPP 218

  Fly   289 --------LKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPAQMLEYLSVERELVFQ 341
                    |..|..|.|:...||.|||.|:.|.::  .:..||:|.:|.:||   |:..||
Human   219 PATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVA--DVDCLPLPRRMADYL---RQYPFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 24/85 (28%)
SOCS 293..333 CDD:295349 14/39 (36%)
CISHNP_037456.5 SH2_CIS 94..181 CDD:198285 24/86 (28%)
SOCS_CIS1 235..275 CDD:239703 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5357
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.