DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and socs2

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001120898.1 Gene:socs2 / 100151723 XenbaseID:XB-GENE-487261 Length:201 Species:Xenopus tropicalis


Alignment Length:183 Identity:49/183 - (26%)
Similarity:92/183 - (50%) Gaps:22/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KKWLEREDAHSPNQIMYKACSEMLNQVWYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLS 226
            |:..:|||.      :.::.||:....||||.::..:::.:|.|.|.|:||||||..:....|:|
 Frog    30 KEGRDREDR------IAESMSELRRSGWYWGNMTVDEAKEKLQDAPEGTFLVRDSSHTDYLLTIS 88

  Fly   227 FRIVNVTLHYRLEYRDNFWHFEEL--------KYESIVEMIEDILHRCTNDNFVCFVKVPNEMQP 283
            .:......:.|:|||:..:..:.:        :::|:|.:||..:....|.      |:.:|..|
 Frog    89 VKTSAGPTNLRIEYREGKFRLDSVVCVRSRLKQFDSVVHLIEYYVLLSKNK------KIESETLP 147

  Fly   284 PFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPAQMLEYLSVER 336
            ...|.|......|::.|.||.|||..:.:  ..:::.:||:|.::.||::..|
 Frog   148 NRTVHLWLVKPLYTSAPSLQHLCRMTVNK--CTDKIDELPLPMRLKEYITEYR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 24/85 (28%)
SOCS 293..333 CDD:295349 12/39 (31%)
socs2NP_001120898.1 SH2_SOCS2 43..145 CDD:198246 28/107 (26%)
SOCS_SOCS2 161..201 CDD:239705 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5105
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.