DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and cishb

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_017213670.1 Gene:cishb / 100136861 ZFINID:ZDB-GENE-080204-120 Length:213 Species:Danio rerio


Alignment Length:175 Identity:45/175 - (25%)
Similarity:68/175 - (38%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 WYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEE---- 249
            ||||.::..|::..|...|.|:||||||......||||.:......:.|:||....:..:.    
Zfish    56 WYWGGLTAGDARAALIGAPEGTFLVRDSSHPLYLFTLSVQTWRGPTNIRIEYDSGRFRLDSSFPA 120

  Fly   250 ----LKYESIVEMI--------------EDILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRY 296
                |.:.::..::              ||..|....|..:.             :.|:.||.|.
Zfish   121 RSCLLSFSALPSLVHHYS
SARPEEEKKAEDHHHMVAKDTGIL-------------LKLRKPLHRP 172

  Fly   297 SNMPKLQDLCRRVLQRQMSREQLAQLPVPAQMLEYLSVERELVFQ 341
            ...|.||.|.|..:.|.....  .:||:|..:|.||   :|..||
Zfish   173 QAFPTLQHLTRLTINRHTDCH--TKLPLPRPLLLYL---QEYPFQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 25/98 (26%)
SOCS 293..333 CDD:295349 13/39 (33%)
cishbXP_017213670.1 SH2_CIS 51..138 CDD:198285 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5344
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.