DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and cish

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_012816010.1 Gene:cish / 100135018 XenbaseID:XB-GENE-490099 Length:266 Species:Xenopus tropicalis


Alignment Length:163 Identity:54/163 - (33%)
Similarity:80/163 - (49%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 WYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEE---- 249
            ||||.|:..::::||...|.|.||||||......||||.|......:.|:||.|..:..:.    
 Frog   101 WYWGSITATEAKQQLQKMPEGFFLVRDSTHPSYLFTLSVRTNRGPTNVRIEYSDGLFRLDSNCLS 165

  Fly   250 ----LKYESIVEMIEDILHRCTNDNFVCFVKVPNEMQPPFP--------VILK--YPLSRYSNMP 300
                |.:..:|.:::..:..|.:|    ..|.|....||.|        |.||  :||.|.:..|
 Frog   166 KPRILSFPDVVSLVQYYV
SFCHSD----VNKEPACQTPPVPPSPKEPAAVHLKLLHPLPRGAQCP 226

  Fly   301 KLQDLCRRVLQRQMS-REQLAQLPVPAQMLEYL 332
            .||.|||..:.|.:: ..:|.:||:|.:|:|||
 Frog   227 SLQHLCRLQINRSLAPNAELTELPLPRRMVEYL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 26/84 (31%)
SOCS 293..333 CDD:295349 17/41 (41%)
cishXP_012816010.1 SH2_CIS 96..183 CDD:198285 26/81 (32%)
SOCS 226..266 CDD:383010 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5105
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.