DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs44A and socs1b

DIOPT Version :9

Sequence 1:NP_523659.1 Gene:Socs44A / 35786 FlyBaseID:FBgn0033266 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001239559.1 Gene:socs1b / 100007521 ZFINID:ZDB-GENE-090313-141 Length:193 Species:Danio rerio


Alignment Length:216 Identity:46/216 - (21%)
Similarity:95/216 - (43%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DDGGTTDATYEFLTPAICPEP-TLPFTHDYLRFIRKKWLEREDAHSPNQIMYKACSEMLNQVWYW 191
            :|.|.|:|..:...|   |:| ::|.||.:      .:.::::.:    ::.:|...:.:..:||
Zfish    12 NDNGHTNAPPKSAEP---PKPCSVPPTHFH------PFRDQQECN----LIKQAVVYLTHSGFYW 63

  Fly   192 GEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHFEELKYESIV 256
            |.:...::..:|::.|.|:||:|||..:...||||:|........|:..::..:.....|:    
Zfish    64 GPLDVDEAHARLANLPLGTFLIRDSMQANVFFTLSYRAPEGPTSVRVLLKNESFSLAGSKH---- 124

  Fly   257 EMIEDILHRCTNDNFVC-------FVKVPNEMQPPFPVILKYPLSR--YSNMPK-LQDLCRRVLQ 311
                         .|.|       ::..|           |..|||  ..::|: ||:|.||.:.
Zfish   125 -------------TFSCIFGLLGYYIASP-----------KKSLSRPYRGDVPQTLQELARRAVV 165

  Fly   312 RQMSREQLAQLPVPAQMLEYL 332
            :...::.:..|||..::.|::
Zfish   166 QSFGKDSIPHLPVSKKLKEFI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs44ANP_523659.1 SH2_SOCS_family 188..266 CDD:198178 18/77 (23%)
SOCS 293..333 CDD:295349 13/43 (30%)
socs1bNP_001239559.1 SH2_SOCS1 50..147 CDD:198245 25/124 (20%)
SOCS 153..186 CDD:295349 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.