DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and GTS1

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_011334.1 Gene:GTS1 / 852694 SGDID:S000003149 Length:396 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:29/136 - (21%)
Similarity:61/136 - (44%) Gaps:25/136 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 SPSLVELQKTVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDL-GVH----HS 478
            |.||..:.:.:...:......::|.:||:... ||.|:|.|:.:|.:|:.|||.: |..    .|
Yeast     7 SHSLKHVDRELKELINSSENANKCGECGNFYP-TWCSVNLGVFLCGRCASVHRKVFGSRDDDAFS 70

  Fly   479 RIQSLTLDNLTTANLLIARAMGNSTLNDIMEAKLGRGKLQHESSMEERYD----------FIRAK 533
            .::||::|..|..::....::|.:.         |..:..:..::...:|          :||.|
Yeast    71 NVKSLSMDRWTREDIDELVSLGGNK---------GNARFWNPKNVPFPFDGDDDKAIVEHYIRDK 126

  Fly   534 YVAKRY 539
            |:..::
Yeast   127 YILGKF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071
ArfGap_ASAP 425..541 CDD:350063 26/130 (20%)
Ank_2 554..662 CDD:403870
ANK repeat 586..622 CDD:293786
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
GTS1NP_011334.1 COG5347 8..310 CDD:227651 28/135 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.