DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and AGE1

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_010812.3 Gene:AGE1 / 852136 SGDID:S000002932 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:61/152 - (40%)
Similarity:84/152 - (55%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 KALTKAFQHANPQMSPSLVELQKTVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGV 469
            |..|:.|..||...| :..|| .:::|.:.  ..|.:||||||...|.|:|:|...::||:||||
Yeast   153 KQHTQHFSFANAGAS-NRDEL-LSIVRKID--KSNLKCCDCGSTATVEWVSINLLCILCIKCSGV 213

  Fly   470 HRDLGVHHSRIQSLTLDNLTTANL--LIARAMGNSTLNDIMEAKLGR---GKLQHESSMEERYDF 529
            ||.||.|.|:|:||||||.|:..|  |:...:.||.:|.|.|:.|..   .|:...|...||..|
Yeast   214 HRSLGSHISKIRSLTLDNFTSLELMHLLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKF 278

  Fly   530 IRAKYVAKRYVMRTCSDDNDLR 551
            |..||..|::|:    |.|..|
Yeast   279 IIDKYQFKKFVI----DSNQGR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071 2/4 (50%)
ArfGap_ASAP 425..541 CDD:350063 50/120 (42%)
Ank_2 554..662 CDD:403870
ANK repeat 586..622 CDD:293786
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
AGE1NP_010812.3 COG5347 164..480 CDD:227651 56/141 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I1760
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46810
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.