DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and GCS1

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_010055.1 Gene:GCS1 / 851372 SGDID:S000002385 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:48/177 - (27%)
Similarity:80/177 - (45%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 NPQMSPSLVELQKTVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSR 479
            :|.....|::|||        :..|.:|.|||:.|. .|.:..||..:|::|:|:||.||||.|.
Yeast     7 DPDTRRRLLQLQK--------IGANKKCMDCGAPNP-QWATPKFGAFICLECAGIHRGLGVHISF 62

  Fly   480 IQSLTLDNLTTANLLIARAMGNSTLND-----IMEAKLGRGKLQHESSMEERYDFIRAKYVAKRY 539
            ::|:|:|......||.....||..|.:     .::..|.: |:::::.:.|.|         |..
Yeast    63 VRSITMDQFKPEELLRMEKGGNEPLTEWFKSHNIDLSLPQ-KVKYDNPVAEDY---------KEK 117

  Fly   540 VMRTCSDDNDLRCDLEQAVVNADMSQLLQVWAEGADLTCCLPSSDAG 586
            :...|.|    |...|:..::.|.|:|.......|..|..:..|..|
Yeast   118 LTCLCED----RVFEEREHLDFDASKLSATSQTAASATPGVAQSREG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071
ArfGap_ASAP 425..541 CDD:350063 35/120 (29%)
Ank_2 554..662 CDD:403870 8/33 (24%)
ANK repeat 586..622 CDD:293786 1/1 (100%)
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
GCS1NP_010055.1 COG5347 4..350 CDD:227651 48/177 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.