DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and 9030624G23Rik

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001369748.1 Gene:9030624G23Rik / 66808 MGIID:1914058 Length:591 Species:Mus musculus


Alignment Length:119 Identity:35/119 - (29%)
Similarity:49/119 - (41%) Gaps:29/119 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSLIAVSEFVEETRSDYSSPTTSTFASRMPDCRHTIGVLEE--------RLEFDREGLTKLKKAV 59
            |..|:|||||.||..||.:||.|:|.:|...||.|...:||        .:.|..|....|..:.
Mouse     2 PDPISVSEFVAETLEDYMAPTASSFTTRTAQCRDTAAAIEEDAVTYDDVHVNFTGEEWKLLDPSQ 66

  Fly    60 KAIHNS------------GNT----HVDNEMFMVRALERL-----GGKVIEQDE 92
            |:::..            |.|    |::......|..||.     |.|:.|.:|
Mouse    67 KSLYKDVMLETYWNLTVIGYTWETHHIEGHCQSSRRNERYVSNHSGEKLYECNE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288 18/87 (21%)
PH_ASAP 302..410 CDD:270071
ArfGap_ASAP 425..541 CDD:350063
Ank_2 554..662 CDD:403870
ANK repeat 586..622 CDD:293786
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
9030624G23RikNP_001369748.1 KRAB 45..85 CDD:396083 4/39 (10%)
C2H2 Zn finger 118..138 CDD:275368 1/3 (33%)
C2H2 Zn finger 147..166 CDD:275368
zf-H2C2_2 158..182 CDD:404364
C2H2 Zn finger 174..194 CDD:275368
COG5048 198..571 CDD:227381
C2H2 Zn finger 202..222 CDD:275368
C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 258..278 CDD:275368
C2H2 Zn finger 286..306 CDD:275368
C2H2 Zn finger 314..334 CDD:275368
C2H2 Zn finger 342..362 CDD:275368
C2H2 Zn finger 370..390 CDD:275368
C2H2 Zn finger 398..418 CDD:275368
C2H2 Zn finger 426..446 CDD:275368
C2H2 Zn finger 454..474 CDD:275368
C2H2 Zn finger 482..502 CDD:275368
C2H2 Zn finger 510..529 CDD:275368
C2H2 Zn finger 538..558 CDD:275368
C2H2 Zn finger 566..586 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.