DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and Adap2

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_038942641.1 Gene:Adap2 / 56826 RGDID:708487 Length:400 Species:Rattus norvegicus


Alignment Length:264 Identity:55/264 - (20%)
Similarity:96/264 - (36%) Gaps:85/264 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 RYVQLL----PGNDRCCDCGSRN-----------------------DVTWISLNFGILVCIQCSG 468
            |.::||    .||..|.|||:..                       |..|.|...|:.:|:.|||
  Rat    10 RLLELLQAAGTGNGHCADCGAAGPACPCTLVQSLSSSAEILLFHPADPDWASYKLGVFICLHCSG 74

  Fly   469 VHR---DLGVHHSRIQSLTLDNLTTANLLIARAMGNSTLNDIMEAKLGRGKLQHESS----MEER 526
            |||   |:    |:::|:.||....:.:......||.::....||::.......::|    ::|:
  Rat    75 VHRNFPDI----SKVKSVRLDFWDDSMVEFMTHNGNLSVKAKFEARVPTFYYVPQASDCLVLKEQ 135

  Fly   527 YDFIRAKYVAKRYVMRTCSDDNDLRCDLEQAV-VNADMSQLLQVWAEGADLTCCLP--------- 581
            :  |||||..:.::             .|:|| ...|....|  |..|.|.:..|.         
  Rat   136 W--IRAKY
ERQEFM-------------AEKAVSPPGDREGFL--WKRGRDNSQFLRRRFVLLSRE 183

  Fly   582 ------SSDAGETALHLAVLREMGSTLHIVDFLIQNMPPKGLNKATNPAGL-LDVTGKNTALHLC 639
                  :.:.|:|...:..::::.:|..             ..|..:|.|| :....:....:|.
  Rat   184 GLLKYYTKEEGKTPKAIINIKDLNATFQ-------------TEKIGHPHGLQITYRKEGQTRNLF 235

  Fly   640 ALHD 643
            ..||
  Rat   236 VYHD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071
ArfGap_ASAP 425..541 CDD:350063 36/143 (25%)
Ank_2 554..662 CDD:403870 19/107 (18%)
ANK repeat 586..622 CDD:293786 4/35 (11%)
ANK repeat 624..662 CDD:293786 5/21 (24%)
Ank_2 636..>693 CDD:403870 3/8 (38%)
SH3_ASAP 1095..1149 CDD:212755
Adap2XP_038942641.1 ArfGap 4..141 CDD:355783 34/136 (25%)
PH1_ADAP 156..264 CDD:270072 16/99 (16%)
PH2_ADAP 278..385 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.