DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and Appl2

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001102211.1 Gene:Appl2 / 362860 RGDID:1563028 Length:662 Species:Rattus norvegicus


Alignment Length:446 Identity:95/446 - (21%)
Similarity:181/446 - (40%) Gaps:108/446 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PDCRHTIGVLEERLEFDREGLT----KLKKAVKAIHNSGNTHVDNEMFMVRALERLGGKVIEQD- 91
            |..|..:.|.||    |...||    :|.:|::.::.:     .|||.:  |.::|..:::..: 
  Rat    17 PQTRSLLSVFEE----DAGTLTDYTNQLLQAMQRVYGA-----QNEMCL--ATQQLSRQLLAYEK 70

  Fly    92 --------EPDIGAAFLKFSVVTKELSALMKTLMQNINNIVMFPVDSMLKSELRGVKGDMKRPFD 148
                    :.::.:....||.|..||:.|...|.:.:.:.::.||....:.:|..| ..:|..|.
  Rat    71 QNFALGKGDEEVISTLHYFSKVMDELNGLHSELAKQLADTMVLPVIQFREKDLTEV-STLKDLFG 134

  Fly   149 KAAKDYE---AKFIKIEKEKKAQAKEAGMVRTEIDAAVVAEEMEKERRLYQLQTCEYLLKYKDIK 210
            .|:.:::   ||:.::.|.     ||...|:|:     ||:|:...||...|.:.:|......::
  Rat   135 LASNEHDLSMAKYSRLPKR-----KENERVKTD-----VAKEVAAARRKQHLSSLQYYCALNALQ 189

  Fly   211 TKTGIELLQHLIEYYHALSNYFKDGLQ----TIEHFGTYIGDLSEKLH-EIKQKQDEDRRSLLDL 270
            .:....:::.||.:.|...|:||.|.:    :::.|.:.:.|:.:.:. |::.:.|:.|.|..:|
  Rat   190 YRKRAAMMEPLIGFAHGQINFFKKGAEMFSKSMDGFLSSVTDMVQSIQVELEAEADKMRVSQQEL 254

  Fly   271 RTVLRS--TPDFERVDNVPSSESRSGGAGYSLHQLQGDKHHGVTRQGHL-LKKSEGKVRRVWQKR 332
            .:|..|  |||   :|......:|                :.:.:.|:| |:...|.|...|: |
  Rat   255 LSVSESVYTPD---IDVATPQINR----------------NLIQKTGYLNLRNKTGLVTTTWE-R 299

  Fly   333 RCRVTSDGFLDIFHADESKPPTRV------NLLTCQIKPV-------------PDDKRGFDLISY 378
            ....|..|.|      ..:|...|      :|..|.:..|             |..|.|..|   
  Rat   300 LYFFTQGGNL------MCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGKPGIIL--- 355

  Fly   379 NRPYHFQAEDEGDQKAWMAVLVNCKEKA-LTKAFQHANPQMSPSLVELQKTVIRYV 433
                  |||...:.:.|:..:.|...:. ||.     ||:  ...::|.:|.::.|
  Rat   356 ------QAESRKEYEEWICAINNISRQIYLTD-----NPE--AVAIKLNQTALQAV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288 50/233 (21%)
PH_ASAP 302..410 CDD:270071 26/128 (20%)
ArfGap_ASAP 425..541 CDD:350063 3/9 (33%)
Ank_2 554..662 CDD:403870
ANK repeat 586..622 CDD:293786
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
Appl2NP_001102211.1 BAR_APPL2 20..234 CDD:153316 51/235 (22%)
BAR-PH_APPL 252..376 CDD:270067 32/158 (20%)
PTB_APPL 480..613 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.