DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and CenG1A

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster


Alignment Length:553 Identity:133/553 - (24%)
Similarity:228/553 - (41%) Gaps:147/553 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 KIEKEKKAQAKEAGMVRT---------EIDAAVVAEEMEKE--------RRLYQLQTCEYL---- 203
            |.:|||:.::.|.|..|:         :..:..:.:|.:|:        |..|.....:|:    
  Fly   435 KADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWKKKYVTLCDDGRLTYHPSLHDYMDDVH 499

  Fly   204 -----LKYKDIKTK-----------TGIELLQHLIEYYHALSNYFKDGLQTIEHFGTYIGDLSEK 252
                 |:|..:|..           |...|...|:.......|...||          ||.|:  
  Fly   500 GKEIPLQYVTVKVPGQKPRGSKSIITNSALTSSLMANGQRAQNTLSDG----------IGCLT-- 552

  Fly   253 LHEIKQKQDEDRRSLLDLRTVLRSTPDFERVDNVPSSESRSGGAGYSLHQ------LQGDKHHGV 311
            |.:..|::..::.|||...::...........|  ||:..||..|.::..      :.|:    |
  Fly   553 LAKDNQRKLSEKLSLLGAGSIAAGAGGEPLKSN--SSQQTSGDEGIAMSNSNSQTFIAGE----V 611

  Fly   312 TRQGHLLKKSEGKVRRVWQKRRCRVTSDGFLDIFHADESKPPTRVNLLTCQIKPVPDDKRGFD-- 374
            ...|:.|:.....|:    ||..|:.|..    ..|:|:                 ||..|::  
  Fly   612 ANAGNKLEAQTPNVK----KRHRRMKSSS----VKANEA-----------------DDNDGYEFY 651

  Fly   375 LISY-NRPYHFQAEDEGDQKAWMAVLVNCKEKALTKAFQHANPQMSPSLVELQKT---------- 428
            ::|. ::.:||:|.:..::..|:|.:    |:.:.|:.|.         :|..||          
  Fly   652 IVSLDSKQWHFEAANSEERDEWVAAV----EQEIFKSLQS---------IESSKTKQATSTDLAA 703

  Fly   429 VIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSRIQSLTLDNLTTANL 493
            ::...|.:|||..|.|||:.|. .|.|||.|:|:||:||||||:||.|.|:::||.||:..:.:|
  Fly   704 MLAIRQRVPGNGFCVDCGAPNP-EWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHL 767

  Fly   494 LIARAMGNSTLNDIMEAKL-GRGKLQHESSMEERYDFIRAKYVAKRYVM-----RTCSDDNDLRC 552
            .:..|:|||..|.:.|:.. .|.|...::|.|::..::|:||.||.::.     .:.........
  Fly   768 SVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQ 832

  Fly   553 DLEQAVVNADMSQLLQVWAE-GADLTCCLPSSDAGETALHLAVLREMGSTLHIVDFLIQNMPPKG 616
            .|.:||:.||:..::.:.|. .:::|....|:....|.|.||.  .:|: |.|...||.|    |
  Fly   833 QLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLAC--AIGN-LAIAQLLIWN----G 890

  Fly   617 LN-KATNPAGLLDVTGKNTALHLCALHDRRECM 648
            .| |.|:                   |:.|.|:
  Fly   891 ANIKHTD-------------------HEGRTCL 904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288 23/125 (18%)
PH_ASAP 302..410 CDD:270071 21/116 (18%)
ArfGap_ASAP 425..541 CDD:350063 49/126 (39%)
Ank_2 554..662 CDD:403870 25/97 (26%)
ANK repeat 586..622 CDD:293786 13/36 (36%)
ANK repeat 624..662 CDD:293786 3/25 (12%)
Ank_2 636..>693 CDD:403870 3/13 (23%)
SH3_ASAP 1095..1149 CDD:212755
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 51/281 (18%)
PH 454..>521 CDD:278594 8/66 (12%)
ArfGap 702..818 CDD:279720 47/116 (41%)
ANK <834..907 CDD:238125 25/97 (26%)
ANK repeat 834..866 CDD:293786 8/31 (26%)
Ank_5 859..907 CDD:290568 18/72 (25%)
ANK repeat 868..897 CDD:293786 13/35 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46810
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.