DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and APPL1

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:746 Identity:152/746 - (20%)
Similarity:278/746 - (37%) Gaps:181/746 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VEETRSDYSSPTTSTFASRMPDCRHTIGVLEERLEFDREGLTKLKKAVKAIHNSGN-----THVD 71
            :|||..|  ||.|          |..:||.||........:.:|.:|:..|:::.|     ||:.
Human     9 IEETLED--SPQT----------RSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLT 61

  Fly    72 NEMFMVRALER--LGGKVIEQDEPDIGAAFLKFSVVTKELSALMKTLMQNINNIVMFPVDSMLKS 134
            :::......:|  |||     |:..:.:...:||.|..|||:....|...:.:.:|||:....:.
Human    62 SKLLKEYEKQRFPLGG-----DDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKER 121

  Fly   135 ELRGVKGDMKRPFDKAAKDYEA---KFIKIEKEKKAQAKEAGMVRTEIDAAVVAEEMEKERRLYQ 196
            :|:.:. .:|..|..|:.|::|   ::.::.|:     :|...|:.|     |.|::...|:...
Human   122 DLKEIL-TLKEVFQIASNDHDAAINRYSRLSKK-----RENDKVKYE-----VTEDVYTSRKKQH 175

  Fly   197 LQTCEYLLKYKDIKTKTGIELLQHLIEYYHALSNYFKDGLQTI-EHFGTYIGDLSEKLHEIKQKQ 260
            .....|......::.|..|.||:.|:.|..|..::||.|.:.: |....::.::...:..::::.
Human   176 QTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM 240

  Fly   261 DEDRRSLLDLRTVLRSTPDFERVDN-----------VPSSESRSGGAGY-------SLHQLQGDK 307
            |.      |:.|:.::..|.|...:           .|.:.:.:..|||       .|.....|:
Human   241 DS------DIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDR 299

  Fly   308 HHGVTRQGHLLKKSEGKVRRVWQKRRCRVTSDGF-LDIFHADESKPPTRVNLLTCQIKPVP-DDK 370
            ....|:.|:|:.::.|.|            :.|. :||.:              |.:..|. :|:
Human   300 QFYFTQGGNLMSQARGDV------------AGGLAMDIDN--------------CSVMAVDCEDR 338

  Fly   371 R-GFDLISYN--RPYHFQAEDEGDQKAWMAVLVNCK---------EKALTKAFQHANPQMSPSLV 423
            | .|.:.|::  :....|||.:.|.:.|:..:.|..         |:...:..|.|...::||..
Human   339 RYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPS 403

  Fly   424 ELQKTVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSRIQSLTLDNL 488
            ..|    |:..|.|.      .|.....|..:.:.|            .||...:.:.:|:||:|
Human   404 FQQ----RHESLRPA------AGQSRPPTARTSSSG------------SLGSESTNLAALSLDSL 446

  Fly   489 TTANLLI---------------ARAMGNS--TLNDIMEAKLGRGKLQHESSMEERYDFIR----- 531
            ...:..|               |:|.|..  ..|...|:. |..|.:.|.|:..:...:|     
Human   447 VAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESG-GSTKSETEDSILHQLFIVRFLGSM 510

  Fly   532 ---------AKYVAKRYVMRTCSDDNDLRCDLEQAVVNADMSQLLQVWAEGADLTCCLP-----S 582
                     ..|...|.::...:..|..|......:|..|..:|:....:...||..||     :
Human   511 EVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYA 575

  Fly   583 SDAGETALHLAVLREMG----STLHIVDFLIQNMPPKGLNKATNPAGLLDVTGKNTALHLCALHD 643
            :......|...|||...    |.|..|.::.:: ..:| .|..:..||    .|..|||  |..|
Human   576 THQENKRLFGFVLRTSSGRSESNLSSVCYIFES-NNEG-EKICDSVGL----AKQIALH--AELD 632

  Fly   644 RRECMKLLLRSGADYELKNSQNKTALDIAKE 674
            ||...|       ..|::..:.|...::.|:
Human   633 RRASEK-------QKEIERVKEKQQKELNKQ 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288 51/224 (23%)
PH_ASAP 302..410 CDD:270071 22/121 (18%)
ArfGap_ASAP 425..541 CDD:350063 26/146 (18%)
Ank_2 554..662 CDD:403870 28/116 (24%)
ANK repeat 586..622 CDD:293786 9/39 (23%)
ANK repeat 624..662 CDD:293786 12/37 (32%)
Ank_2 636..>693 CDD:403870 10/39 (26%)
SH3_ASAP 1095..1149 CDD:212755
APPL1NP_036228.1 Required for RAB5A binding 1..428 100/488 (20%)
BAR_APPL1 20..234 CDD:153315 51/229 (22%)
BAR-PH_APPL 252..376 CDD:270067 28/149 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434 11/58 (19%)
F&H 403..414 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491 6/24 (25%)
PTB_APPL 490..625 CDD:269980 27/140 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.