DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and Agap2

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_006513621.1 Gene:Agap2 / 216439 MGIID:3580016 Length:1342 Species:Mus musculus


Alignment Length:265 Identity:79/265 - (29%)
Similarity:127/265 - (47%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 KSEGKVRRVWQKRRC-RVTSDGFL-DIFHADESKPPTRVNLLTCQIKPVPDDKRGFDLI---SYN 379
            |:||...:...||:. ::.|.|.| :|:.|:|:                      |:.:   |..
Mouse   837 KTEGSAVQAEAKRKMWKLKSFGSLRNIYKAEEN----------------------FEFLIVSSTG 879

  Fly   380 RPYHFQAEDEGDQKAWMAVL-------VNCKEKALTKAFQHANPQMSPSLVELQKTVIRYVQLLP 437
            :.:||:|....::.||:..:       :.|.|.:..|....:         :.:...|:.::...
Mouse   880 QTWHFEAASFEERDAWVQAIESQILASLQ
CCESSKVKLRTDS---------QSEAVAIQAIRNAK 935

  Fly   438 GNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSRIQSLTLDNLTTANLLIARAMGNS 502
            ||..|.|||:.|. ||.|||.|.|:||:|||:||:||.|.||::||.||:......|:..|:||.
Mouse   936 GNSTCVDCGAPNP-TWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGND 999

  Fly   503 TLNDIMEAKL-GRGKLQHESSMEERYDFIRAKYVAKRYVMRTCSDDNDLRCDLEQAVVNADMSQL 566
            |.|.:.|:.. ||.|...:||.|||..:|||||....::....:.:..|...|..||...|::.:
Mouse  1000 TANRVWESDTRGRAKPTRDSSREERESWIRAKYE
QLLFLAPLGTTEEPLGRQLWAAVEAQDVAAV 1064

  Fly   567 LQVWA 571
            |.:.|
Mouse  1065 LLLLA 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071 20/101 (20%)
ArfGap_ASAP 425..541 CDD:350063 51/116 (44%)
Ank_2 554..662 CDD:403870 6/18 (33%)
ANK repeat 586..622 CDD:293786
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
Agap2XP_006513621.1 PHA03247 <52..320 CDD:223021
Centaurin_gamma 401..560 CDD:133303
PH_AGAP 668..908 CDD:241281 18/92 (20%)
ArfGap_AGAP 926..1033 CDD:350065 50/107 (47%)
SelP_N <1136..1188 CDD:368014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.