DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and AGAP1

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_006712302.2 Gene:AGAP1 / 116987 HGNCID:16922 Length:1151 Species:Homo sapiens


Alignment Length:403 Identity:106/403 - (26%)
Similarity:173/403 - (42%) Gaps:75/403 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 DNVPSSESRSGGAGYSLHQLQGDKHHGVTRQGHLLKKS-------------EGKVRRVWQKRRCR 335
            |:|.||.|.|....   .:|.........|:.|..|||             |.| |:.|:..|. 
Human   769 DSVCSSPSISSTTS---PKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEAK-RKAWKLNRV- 828

  Fly   336 VTSDGFLDIFHADESKPPTRVNLLTCQIKPVPDDKRGFDLISYN---RPYHFQAEDEGDQKAWMA 397
                |.|...::..:.              ..:.:..|:.|..:   :.:||:|....::.||:.
Human   829 ----GSLRNIYSSSTN--------------TEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQ 875

  Fly   398 VLVNCKEKALTKAFQHANPQMSPSLVELQK--TVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGI 460
            .:    |..:..:.|......:.|.:..|.  ..::.::.:.||..|.||.::|. .|.|||.|.
Human   876 AI----ESQILASLQSCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQNP-NWASLNLGA 935

  Fly   461 LVCIQCSGVHRDLGVHHSRIQSLTLDNLTTANLLIARAMGNSTLNDIM-EAKLGRGKLQHESSME 524
            |:||:|||:||:||.|.||::||.||:.....:.:..::||...|.:. |:..||.|...:|:.|
Human   936 LMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTRE 1000

  Fly   525 ERYDFIRAKYVAKRYVMRTCSDDNDLRCDLEQAVVNADMSQLLQVWAEGA----DLTCCLPSSDA 585
            |:..:|||||..|.::......:..|...|.:|..:.|:...:.:.|.|:    :.||   ....
Human  1001 EKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETC---GEGD 1062

  Fly   586 GETALHLAVLREMGSTLHIVDFLIQNMPPKGLNKATNPAGLLDVTGK----NTALHLCALHDRRE 646
            |.||||||..:  |:.:     |.|.:...|          :|||.:    ||||........:|
Human  1063 GRTALHLACRK--GNVV-----LAQLLIWYG----------VDVTARDAHGNTALAYARQASSQE 1110

  Fly   647 CMKLLLRSGADYE 659
            |:.:||:.|...|
Human  1111 CIDVLLQYGCPDE 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071 21/123 (17%)
ArfGap_ASAP 425..541 CDD:350063 45/118 (38%)
Ank_2 554..662 CDD:403870 31/114 (27%)
ANK repeat 586..622 CDD:293786 11/35 (31%)
ANK repeat 624..662 CDD:293786 13/40 (33%)
Ank_2 636..>693 CDD:403870 7/24 (29%)
SH3_ASAP 1095..1149 CDD:212755
AGAP1XP_006712302.2 Centaurin_gamma 337..498 CDD:133303
RAS 338..504 CDD:214541
PH_AGAP 613..886 CDD:241281 27/143 (19%)
PH 616..>680 CDD:278594
PH <830..881 CDD:278594 9/68 (13%)
ArfGap 905..1019 CDD:279720 44/114 (39%)
Ank_2 1030..1120 CDD:289560 29/109 (27%)
ANK 1030..>1119 CDD:238125 29/108 (27%)
ANK repeat 1062..1093 CDD:293786 14/47 (30%)
ANK repeat 1095..1120 CDD:293786 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.