DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asap and smap2

DIOPT Version :9

Sequence 1:NP_001014504.1 Gene:Asap / 35783 FlyBaseID:FBgn0050372 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_002938524.3 Gene:smap2 / 100496482 XenbaseID:XB-GENE-5817085 Length:422 Species:Xenopus tropicalis


Alignment Length:126 Identity:48/126 - (38%)
Similarity:67/126 - (53%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 VELQKTVIRYVQLLPGNDRCCDC---GSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSRIQSLT 484
            ||..:.|:..:.|...|..|.||   |.|    |.|.|.|:.|||:|:||||:||||.||::|:.
 Frog     9 VERYQAVLSELLLREENKFCADCLAKGPR----WASWNIGVFVCIRCAGVHRNLGVHISRVKSVN 69

  Fly   485 LDNLTTANLLIARAMGNSTLNDIMEAKLGRG--KLQHESSMEERYDFIRAKYVAKRYVMRT 543
            ||..|...:.....|||.....:.||.|...  :.|.:.::|.   |||.||..|:|:.|:
 Frog    70 LDQWTQEQIQCMEEMGNGKAKRLYEAFLPDNFIRPQTDQAVEV---FIREKYEKKKYMDRS 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsapNP_001014504.1 BAR_ASAPs 35..249 CDD:153288
PH_ASAP 302..410 CDD:270071
ArfGap_ASAP 425..541 CDD:350063 45/120 (38%)
Ank_2 554..662 CDD:403870
ANK repeat 586..622 CDD:293786
ANK repeat 624..662 CDD:293786
Ank_2 636..>693 CDD:403870
SH3_ASAP 1095..1149 CDD:212755
smap2XP_002938524.3 ArfGap_SMAP2 16..122 CDD:350083 42/112 (38%)
Med15 270..>411 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.