DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul4 and AT3G46910

DIOPT Version :9

Sequence 1:NP_001163084.1 Gene:Cul4 / 35780 FlyBaseID:FBgn0033260 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:241 Identity:60/241 - (24%)
Similarity:105/241 - (43%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KPTLPDN-------YSKDTYVKLEEAVIAIQLSKPIKYSLEELYQAV-VNMCSHKMDAQLYAKLK 166
            ||.:|..       |.:|.:..|:.|:.||.|.:|..::...|:.|| .:.|.......||..:.
plant    11 KPIIPHTPKPDSRIYVEDAWTMLKPAIRAIFLDEPQDFACSGLFNAVNKSWCEKSSGEALYKLIL 75

  Fly   167 ELTEQHVKRNIKLKELTGGSMDKLILLEKINHWWLSFCQQMIMIRSIFLYMDRTYVLQNSTV--H 229
            |..|.::...|:..| :....|..:.|..:...||.|.:::..:.||       ...:..||  |
plant    76 EECEIYISAAIQSLE-SQCDTDPSLFLSLLEKCWLDFRRKLQFLCSI-------AGGEGQTVGPH 132

  Fly   230 SIWDMGLDLFRIHFAQNSVVQKRTVDGLLTLIEKERQGSTVDRGLLKSLVRMLCDL--------- 285
            |:||:|.:|...|......|:.:.:..:|.||..:|...:||...||:..|.:..:         
plant   133 SVWDLGSELSPKHLFSAQKVRDKLLSIILQLIRDQRSFMSVDMTQLKNTTRPVMSVHMTQLNNLR 197

  Fly   286 ------QIYTSSFEEK-FLDATNQLYKAESQRKMQELEVPEYLQHV 324
                  .:|.|.|.:| |:|...:.|.||:.:..::.::|.||:.|
plant   198 GLFYGQSLYKSPFFKKPFIDCAVEFYSAEAMQFKEQSDIPLYLKRV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul4NP_001163084.1 Cullin 124..721 CDD:279260 55/220 (25%)
CULLIN 503..644 CDD:214545
Cullin_Nedd8 750..815 CDD:214883
AT3G46910NP_190275.1 Cullin 33..>244 CDD:279260 55/219 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.