DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul4 and Cacul1

DIOPT Version :9

Sequence 1:NP_001163084.1 Gene:Cul4 / 35780 FlyBaseID:FBgn0033260 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_084473.1 Gene:Cacul1 / 78832 MGIID:1926082 Length:377 Species:Mus musculus


Alignment Length:331 Identity:71/331 - (21%)
Similarity:128/331 - (38%) Gaps:86/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKYKPMDTTELHENTENIAACLKKAENVAPTAAAASSVGRSAFAAQNMNSASTNGERLPNFSKLG 69
            |:..||....|.| ...:...||..:       ||::|.::|.|..:.::.:.|           
Mouse    79 KEGLPMGPPPLPE-PNGVIMMLKSCD-------AAAAVAKTAPAPTSSSTININ----------- 124

  Fly    70 GSHGEIRTASTTSNLLNRMGAIHNSKPGDVKKIVIKNFKDKPTLPDNYSKDTY-VKLEEAVIAIQ 133
                    .||:..|:|              .|.|:::           |.|| .||:.|:..:.
Mouse   125 --------TSTSKFLMN--------------VITIEDY-----------KSTYWPKLDGAIDQLL 156

  Fly   134 LSKP---IKYSLEELYQAVVNMCSHKMDAQLYAKLKELTEQHVKRNIKLKELTGGSMDKLILLEK 195
            ...|   |..|.|::|..|......:...|:|:.|.:....|::|  ..|||.....|  :.:|:
Mouse   157 TQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITSHLER--VSKELQASPPD--LYIER 217

  Fly   196 INHWWLSFCQQMIMIRSI---FLYMDRTYVLQNSTVHSIWDMGLDLFRIHFAQNSVVQKRTVDGL 257
            .|   ::..|.|..::||   |:||::.|: :......:.|..:.||..|     |.:|.....:
Mouse   218 FN---IALGQYMGALQSIVPLFIYMNKFYI-ETKLNRDLKDDLIKLFTEH-----VAEKHIYSLM 273

  Fly   258 LTLIEKERQGSTVDRGLLKSLVRMLCDL-----QIYTSSFEEKFL--------DATNQLYKAESQ 309
            ..|:|.:.....|....:.::|:.|..|     |:..:.| .||:        ::....|.|:.|
Mouse   274 PLLLEAQSTPFQVTPSTMANIVKGLYTLRPEWVQMAPTLF-SKFIPNILPPAVESELSEYAAQDQ 337

  Fly   310 RKMQEL 315
            :..:||
Mouse   338 KLQREL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul4NP_001163084.1 Cullin 124..721 CDD:279260 49/211 (23%)
CULLIN 503..644 CDD:214545
Cullin_Nedd8 750..815 CDD:214883
Cacul1NP_084473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Cullin 146..>264 CDD:279260 32/130 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.