DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul4 and CACUL1

DIOPT Version :9

Sequence 1:NP_001163084.1 Gene:Cul4 / 35780 FlyBaseID:FBgn0033260 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_722517.3 Gene:CACUL1 / 143384 HGNCID:23727 Length:369 Species:Homo sapiens


Alignment Length:313 Identity:68/313 - (21%)
Similarity:120/313 - (38%) Gaps:94/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AACLKKAENVAPTAAAASSVGRSAFAAQNMNSASTNGERLPNFSKLGGSHGEIRTASTTSNLLNR 87
            ||.:.||   ||...|:|::        |:|:                        ||:..|:| 
Human    97 AAAVAKA---APAPTASSTI--------NINT------------------------STSKFLMN- 125

  Fly    88 MGAIHNSKPGDVKKIVIKNFKDKPTLPDNYSKDTY-VKLEEAVIAIQLSKP---IKYSLEELYQA 148
                         .|.|:::           |.|| .||:.|:..:....|   |..|.|::|..
Human   126 -------------VITIEDY-----------KSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSC 166

  Fly   149 VVNMCSHKMDAQLYAKLKELTEQHVKRNIKLKELTGGSMDKLILLEKINHWWLSFCQQMIMIRSI 213
            |......:...|:|:.|.:....|::|  ..|||.....|  :.:|:.|   ::..|.|..::||
Human   167 VYKCVCQQHSEQMYSDLIKKITNHLER--VSKELQASPPD--LYIERFN---IALGQYMGALQSI 224

  Fly   214 ---FLYMDRTYVLQNSTVHSIWDMGLDLFRIHFAQNSVVQKRTVDGLLTLIEKERQGSTVDRGLL 275
               |:||::.|: :......:.|..:.||..|     |.:|.....:..|:|.:.....|....:
Human   225 VPLFIYMNKFYI-ETKLNRDLKDDLIKLFTEH-----VAEKHIYSLMPLLLEAQSTPFQVTPSTM 283

  Fly   276 KSLVRMLCDL-----QIYTSSFEEKFL--------DATNQLYKAESQRKMQEL 315
            .::|:.|..|     |:..:.| .||:        ::....|.|:.|:..:||
Human   284 ANIVKGLYTLRPEWVQMAPTLF-SKFIPNILPPAVESELSEYAAQDQKFQREL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul4NP_001163084.1 Cullin 124..721 CDD:279260 49/211 (23%)
CULLIN 503..644 CDD:214545
Cullin_Nedd8 750..815 CDD:214883
CACUL1NP_722517.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Cullin 138..>256 CDD:279260 32/130 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.