DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmem63 and AT4G22120

DIOPT Version :10

Sequence 1:NP_610351.1 Gene:Tmem63 / 35779 FlyBaseID:FBgn0033259 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_193943.2 Gene:AT4G22120 / 828301 AraportID:AT4G22120 Length:771 Species:Arabidopsis thaliana


Alignment Length:210 Identity:39/210 - (18%)
Similarity:72/210 - (34%) Gaps:67/210 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RWNNSL--RVVVPANNYLSQQQQQNENETTEQSQELAEQSNAPE--SIDPECLIKHPLQHTWTLW 89
            :|:..|  |||.      |...|.|:||.|   :.:....:.|.  :.:|| :|.|.|:......
plant   385 KWSIDLQKRVVE------SGPDQLNDNEYT---KFIPPNYHTPPYLTAEPE-VIYHRLRPKDKFL 439

  Fly    90 YLEVDRTKKWTDSMNEVTSFSTVEDFWSLFNHIRGPSEIKVGGDYMLFKSHIRPMWEDDANKHGG 154
            .|..|                      .|:..:.....:::.|:|:....|.:|:      ..||
plant   440 ILATD----------------------GLWETMHRQDVVRIVGEYLTGVHHQQPL------AVGG 476

  Fly   155 -RWTIS------MNKRLSDKCWLDTVLCLIGETFEHSDQICGATVNVRQKIDKISIWTADYDNRA 212
             :.|:.      |.:|           ..|...||..:   .||..:|..:........|::..:
plant   477 YKVTLGQMQGLLMERR-----------ARISSVFEDQN---AATHLIRHAVGNNEFGAVDHERLS 527

  Fly   213 AVL----DIGRTYKE 223
            .:|    ::.|.|::
plant   528 KMLSLPEELARMYRD 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmem63NP_610351.1 COG5594 20..683 CDD:227881 39/210 (19%)
RSN1_7TM 398..660 CDD:460661
AT4G22120NP_193943.2 COG5594 3..680 CDD:227881 39/210 (19%)
RSN1_7TM 374..645 CDD:460661 39/210 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.