DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmem63 and tmem63bb

DIOPT Version :9

Sequence 1:NP_610351.1 Gene:Tmem63 / 35779 FlyBaseID:FBgn0033259 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001313336.1 Gene:tmem63bb / 569678 ZFINID:ZDB-GENE-030131-7663 Length:179 Species:Danio rerio


Alignment Length:174 Identity:48/174 - (27%)
Similarity:76/174 - (43%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 IYICLKHFVDRHNLYFAYGPSNMISRKGGKIHSTAVTMTKFSVVILVLVMAMICFFR-------G 667
            :|:.|||.|||:|:|:||.||.:    ..||||.||...   |...:|.:..:.||.       .
Zfish     1 MYMLLKHLVDRYNMYYAYLPSKL----DKKIHSGAVNQV---VAAPILCLFWLLFFSTVRIGFLT 58

  Fly   668 DNGMARFLLLIISLAITLT-----LFTFMSPIKRCAATRRPSI--VEIAGPA---------PIYV 716
            ...|..|::|||::.:.|:     .|.::|.......|:...:  ||...||         .:|:
Zfish    59 PTSMFTFVVLIITIVVCLSHVCFGHFKYLSAHNYKIDTKDTEVDGVENGRPARSSPSNKSQQMYI 123

  Fly   717 PDVLKD-NGIRTSSVRPSAAAFGGYGSDSVSEYDSSQYSVNSVE 759
            ..||:| |...|.:   .:....|.||....|..::..|:|..:
Zfish   124 AQVLQDPNSDETGA---GSGEDDGQGSSQDEEMINAGNSLNEAD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmem63NP_610351.1 RSN1_TM 32..220 CDD:290675
PHM7_cyt 270..328 CDD:291375
RSN1_7TM 347..663 CDD:280815 21/52 (40%)
tmem63bbNP_001313336.1 RSN1_7TM <1..57 CDD:280815 23/62 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395194at2759
OrthoFinder 1 1.000 - - FOG0001439
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.