DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and KCNK6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_004814.1 Gene:KCNK6 / 9424 HGNCID:6281 Length:313 Species:Homo sapiens


Alignment Length:360 Identity:82/360 - (22%)
Similarity:130/360 - (36%) Gaps:115/360 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENI-SFFDHHA 98
            |.:.....|::.||.:...:|.....||::|      ......:.|.|...:.|..: :|.:...
Human     9 GALAAYAAYLVLGALLVARLEGPHEARLRAE------LETLRAQLLQRSPCVAAPALDAFVERVL 67

  Fly    99 YRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYA 163
            ...|:..|:|    |.........| ..|.|:.|..::.|:|||:|||..||.::.||..:|.:|
Human    68 AAGRLGRVVL----ANASGSANASD-PAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFA 127

  Fly   164 IIGMPLFLLYLSNIGDVLA----------KSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLAR 218
            ::|:|..:|.|:.....|:          .|.:|.:..                         .|
Human   128 LLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDP-------------------------RR 167

  Fly   219 ALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEI 283
            |...|                                    ||.:                   :
Human   168 AACWH------------------------------------LVAL-------------------L 177

  Fly   284 TVPVTVCVFVMVGYILWGALLFGRWED-WNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVE 347
            .|.||||..|       .|::|...|: |::||..|||.||||:||.||.|||:......|...:
Human   178 GVVVTVCFLV-------PAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYK 235

  Fly   348 VSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAI 382
            |   |..:||.||:  :||...|...:.|.::..:
Human   236 V---LVTVYLFLGL--VAMVLVLQTFRHVSDLHGL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 22/69 (32%)
Ion_trans_2 292..377 CDD:285168 31/85 (36%)
KCNK6NP_004814.1 Ion_trans_2 <91..146 CDD:285168 20/54 (37%)
Ion_trans_2 180..256 CDD:285168 35/87 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10857
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.