DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and CG42594

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster


Alignment Length:275 Identity:96/275 - (34%)
Similarity:157/275 - (57%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSF 185
            ||. .:|:|:.||||||||:|||||||:.|.:..|::||:.||..|:||.|:|||:.|.:||:..
  Fly   595 GPP-HEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVA 658

  Fly   186 KWIYSKVCLCRICPGVA-----KRRIIRERRKMRQLARALQMHDMENARGSSSYTST--SSTTSS 243
            :.::||...|.:|....     ::|:..:.|:||:..:..::...:.......|...  .:|...
  Fly   659 REVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEK 723

  Fly   244 NSSSSEYTRSS----RQSSSLVDIQYTESDSDIEREIRGSTDEITV--PVTVCVFVMVGYILWGA 302
            ::.:.....::    .....|.||     ||....|.|||...:::  |:.:|..:|:.||::||
  Fly   724 DAGAGAPPPNAGGPVGSVGGLGDI-----DSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGA 783

  Fly   303 LLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMC 367
            .:..|.|.|..|||.|||.:|||:|||||::||.|     |:....:: .|::|::.||.:.|||
  Fly   784 AVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLR-----RESNATTW-FCSVYIMSGMTLTAMC 842

  Fly   368 FNLMQEQVVHNIRAI 382
            ||::.|::||.||.:
  Fly   843 FNVIHEEIVHRIRIV 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 32/59 (54%)
Ion_trans_2 292..377 CDD:285168 36/84 (43%)
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 32/56 (57%)
Ion_trans <601..640 CDD:278921 22/38 (58%)
Ion_trans_2 774..846 CDD:285168 35/77 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472735
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.