DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and TOK1

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_012442.1 Gene:TOK1 / 853352 SGDID:S000003629 Length:691 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:49/206 - (23%)
Similarity:84/206 - (40%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GAFLYSLTV-ITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCL 194
            |..||..|| :.|:|.|:|.|.|...|::.:::::.|:.|..|.:.....::.||...|:.    
Yeast   275 GNALYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLMGLIVFMTRSIIQKSSGPIFF---- 335

  Fly   195 CRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSS-SYTSTSSTTSSNSSSSEYTRSSRQSS 258
                                       .|.:|..|..| .:...||...|...:.:..:..||::
Yeast   336 ---------------------------FHRVEKGRSKSWKHYMDSSKNLSEREAFDLMKCIRQTA 373

  Fly   259 SLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLIS 323
            |.....::.|                  ||:.:|  :.:.|.|||:|...|:|:|.:..|||.:.
Yeast   374 SRKQHWFSLS------------------VTIAIF--MAFWLLGALVFKFAENWSYFNCIYFCFLC 418

  Fly   324 LSSIGFGDLVP 334
            |.:||:||..|
Yeast   419 LLTIGYGDYAP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 15/52 (29%)
Ion_trans_2 292..377 CDD:285168 18/43 (42%)
TOK1NP_012442.1 Ion_trans_2 253..328 CDD:400301 15/52 (29%)
Ion_trans_2 388..462 CDD:400301 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345205
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.