DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and KCNK16

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:313 Identity:66/313 - (21%)
Similarity:119/313 - (38%) Gaps:121/313 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIGGAFIFQSIE---------IFEYERLKSEKPHRFIARNFSGECLSRIWELTAENI 91
            ::|....|::.||.|||.:|         .|:.|:|      ||:                 ||.
Human    17 LLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKL------RFL-----------------ENY 58

  Fly    92 SFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGK 156
            :..|..|..:.|..::..:.:.:..|. ...:...|.|..:|.::.||:|||||||:.|.:|.|:
Human    59 TCLDQWAMEQFVQVIMEAWVKGVNPKG-NSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQ 122

  Fly   157 LVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQ 221
            :..:.||::|:||.:::|:::|                                       ..|:
Human   123 VFCVFYALLGIPLNVIFLNHLG---------------------------------------TGLR 148

  Fly   222 MHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIER-EIRGSTDEITV 285
            .|                                             .:.||| |.|....::..
Human   149 AH---------------------------------------------LAAIERWEDRPRRSQVLQ 168

  Fly   286 PVTVCVFVMVG---YILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPG 335
            .:.:.:|:.:|   .:::..::|...|.|::.:|.||..|:||:|||||.|.|
Human   169 VLGLALFLTLGTLVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 22/59 (37%)
Ion_trans_2 292..377 CDD:285168 18/47 (38%)
KCNK16NP_001128577.1 Ion_trans_2 <92..148 CDD:311712 22/94 (23%)
Ion_trans_2 180..>224 CDD:311712 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9913
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.