DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and TPK4

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_171752.1 Gene:TPK4 / 837846 AraportID:AT1G02510 Length:284 Species:Arabidopsis thaliana


Alignment Length:276 Identity:56/276 - (20%)
Similarity:96/276 - (34%) Gaps:98/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSN--IG 178
            :.|..|.:..  .|..||.:|:...:|:|||:|.|.:...|::||:....|: :||.||.|  :.
plant    57 RDQFSGTETN--LFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVLVSTGV-VFLDYLLNRVVS 118

  Fly   179 DVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSS 243
            .||:                  :.:..|:....|.|.  ||::.|..|:.:              
plant   119 HVLS------------------LQENAILDRINKTRN--RAIRDHIAEDGK-------------- 149

  Fly   244 NSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCV-FVMVGYILW-GALLFG 306
                                                   |.:...:|: |..||..:. |||...
plant   150 ---------------------------------------IRLKWKLCLAFCAVGLCVGSGALFLH 175

  Fly   307 RWEDWNYLDGSYFCLISLSSIGFGD----LVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMC 367
            .:|..::||..|..:||::::|:||    .|.|..              ....:|||....:|..
plant   176 VFERLDWLDSVYLSVISVTTVGYGDKTFKTVEGRG--------------FAVFWLLLSTIAMATL 226

  Fly   368 FNLMQEQVVHNIRAIK 383
            |..:.|..:.....:|
plant   227 FLYLAEMRIDRTTVMK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 21/61 (34%)
Ion_trans_2 292..377 CDD:285168 23/89 (26%)
TPK4NP_171752.1 Ion_trans_2 40..118 CDD:285168 21/63 (33%)
Ion_trans_2 169..233 CDD:285168 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.