DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and KCO3

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001190480.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:166 Identity:37/166 - (22%)
Similarity:63/166 - (37%) Gaps:48/166 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 TSTSSTTSSNSSSSEYTRSSRQSSSL--------VDIQYTESDSDIEREIRGSTDEITVP----- 286
            |:|.......:..|.....:||:.:|        |.|.:...|||...:    |..:.|.     
plant    48 TATDMAPDQETEQSVSKSIARQALALLVVYLSLGVLIYWLTLDSDNAYQ----THPVAVALYFFV 108

  Fly   287 VTVCVFVMVGYIL---WGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEV 348
            ||.|.|::|.:::   |             ||...|.::.::::||||......:.|        
plant   109 VTFCGFLIVHFVVKIGW-------------LDSFCFSVMMVTTVGFGDRAFNTWLGT-------- 152

  Fly   349 SFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKR 384
              .|.|::||:....:|..|..:.:     .||.||
plant   153 --FLAAVWLLVSTLAVARAFLFLAD-----ARADKR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168
Ion_trans_2 292..377 CDD:285168 17/87 (20%)
KCO3NP_001190480.1 Ion_trans_2 104..176 CDD:285168 20/99 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.